PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0805
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 276aa    MW: 30964.5 Da    PI: 6.5084
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0805genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.3e-172673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde l++++k  Ggg+W+t +++ g+ R++k+c++rw +yl
      Gh_A13G0805 26 KGPWTAEEDEVLANYIKIEGGGRWRTLPKRAGLLRCGKSCRLRWMNYL 73
                     79******************************99************97 PP

2Myb_DNA-binding44.82.9e-1479124148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+  ++E++l+++++++ G++ W++Ia +++ gRt++++k++w+++l
      Gh_A13G0805  79 RGPIAPDEEDLILRLHRLVGNR-WALIAGRIP-GRTDNEIKNYWNTHL 124
                      566679****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.982173IPR017930Myb domain
SuperFamilySSF466892.02E-2823120IPR009057Homeodomain-like
SMARTSM007171.8E-112575IPR001005SANT/Myb domain
PfamPF002495.1E-142673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-212780IPR009057Homeodomain-like
CDDcd001678.54E-102873No hitNo description
PROSITE profilePS5129423.72874128IPR017930Myb domain
SMARTSM007176.6E-1478126IPR001005SANT/Myb domain
PfamPF002492.7E-1380124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2481129IPR009057Homeodomain-like
CDDcd001674.26E-1184124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MKKPILLGTS TVTSRTPCCS KVGIKKGPWT AEEDEVLANY IKIEGGGRWR TLPKRAGLLR  60
CGKSCRLRWM NYLRPTVKRG PIAPDEEDLI LRLHRLVGNR WALIAGRIPG RTDNEIKNYW  120
NTHLSKNLIS QGIDPRTHKP LNPVSHSSSQ ANQDDDDDVP ESNPNPPSSS KSSELMGEKT  180
NSMATTNLES HQIYQHQQEV GDDCMGQPSS SGNGGDLVEN GNEDHMFSLF LDSLITDNQQ  240
QQQQSNNGDL WEAEIMSPMV EFGNPQNYFN HHQQHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23261287108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465121.10.0PREDICTED: transcription repressor MYB5-like
TrEMBLA0A0D2VDR90.0A0A0D2VDR9_G
STRINGPOPTR_0013s05300.11e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-77myb domain protein 5